SUPERFAMILY 1.73 HMM library and genome assignments server

  Home > Genomes > Escherichia coli K-12 subMG1655 > gi|16128752|ref|NP_415305.1|

Domain assignment for gi|16128752|ref|NP_415305.1| from Escherichia coli K-12 subMG1655

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  gi|16128752|ref|NP_415305.1|
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily MoaD/ThiS 3.21e-22
Family MoaD 1.58e-05
Further Details:      
 

Protein sequence

External link(s) gi|16128752|ref|NP_415305.1|
Sequence length 81
Comment molybdopterin synthase, small subunit [Escherichia coli str. K-12 substr. MG1655]
Sequence 
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLV
SFDHPLTDGDEVAFFPPVTGG
Download sequence
Identical sequences A7ZY40 A8W2W9 B1IXI4 B1X7B4 B2N6Y0 B2TVE6 B3HJQ2 B3I7G6 B3IL59 B7M756 P30748 Q324A8
1fm0D gi|260854075|ref|YP_003227966.1| gi|82543231|ref|YP_407178.1| gi|238900043|ref|YP_002925839.1| gi|170080443|ref|YP_001729763.1| gi|89107635|ref|AP_001415.1| gi|157160259|ref|YP_001457577.1| gi|260843026|ref|YP_003220804.1| gi|218553367|ref|YP_002386280.1| gi|187732069|ref|YP_001881030.1| gi|170020860|ref|YP_001725814.1| gi|260866951|ref|YP_003233353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@mrc-lmb.cam.ac.uk or use the feedback form.

© Copyright 2001-2010 The Medical Research Council and the SUPERFAMILY authors; Derek Wilson, Martin Madera and Julian Gough.